RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL Host Mouse Reactivity Human Interspecies Antigen Sequence Mouse (76); Rat (77) Isotype IgG Quality Control Testing Antibody Reactive Against Recombinant Protein. ...
The antibody 2G1 was subsequently fully characterized physic-chemically and biologically, as well as evaluated in potential clinical applications. Fig. 1: Cell isolation, antibody cloning, and candidate panning. a Isolation strategy of highly potent neutralizing antibodies as depicted by a diagram. b ...
GNL = galanthus nivalis lectin, EBL = elderberry bark lectin/sambucus nigra agglutinin; HPA = helix pomatia agglutinin, VVL = vicia villosa lectin, DBA = dolichol biflorous agglutinin, A4 = mAb A4, α-Lex = anti-Lewis X antibody, α-H = anti-H type...
Neutralizing antibody titers were calculated using the Kärber formula and normalized to a 1 mg/mL solution [35]. 2.6. FPLC Gel Filtration Analysis and Immunoblotting Purified anti-PV IgA mAbs from hybridomas were dialyzed against PBS and fractionated by size exclusion chromatography (SEC) on a...
Keywords: IDH1; R132H; novel rabbit monoclonal antibody; B-cell cloning; immunohistochemistry 1. Introduction Isocitrate dehydrogenase 1 (IDH1) functions as an enzyme in the Krebs (citric acid) cycle and is biologically active in the cytoplasmic and peroxisomal compartments under normal conditions [1...