International Journal of CancerWersall P, Fagerberg J, Ohlsson I, et al. Induction of a T- and B-cell response against a unique amino acid sequence of the mouse IgG2A hinge region in a MAb-treated patient. Int J Cancer 1997 Dec; 73 (6): 790–4...
Molecular Structure: A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa). Applications: Suitable for Size 25ug Concentration n/a Applications ELISA Other Names CD274 Human, ...
The sequence of the upper hinge region is presented for each subtype in red. For the sake of clarity, only one heavy chain was presented. The models of M18 IgG1, IgG2a and IgG3 variants were generated with C-score greater than 0.9, which indicates high confidence of the predicted models....
On the fragmentation of monoclonal IgG1, IgG2a, and IgG2b from BALB/c mice. Journal of immunology 131, 2895–2902 (1983). 50. Parham, P., Androlewicz, M. J., Brodsky, F. M., Holmes, N. J. & Ways, J. P. Monoclonal antibodies: purification, fragmentation and application to ...
Genscript (Piscataway, NJ) synthesized the TWF9 antibody using the DNA sequences of the whole kappa chain and the variable region heavy chain of GW-23B7. The DNA sequence for the heavy chain was followed in frame by the DNA sequence for three constant domains and hinge region of a murine...
(p.Dom, UniProt accession no. P04958), p2-p30 (QYIKANSKFIGITEL-FNFSFWLRVPKVSASHLE), flexible linker consisting of four glycines and a serine, extracellular domain of mouse ROR1 (mROR1-ECD; UniProt Q9Z139), and Fc fragment of mouse IgG2a (hinge region and CH2-CH3 domains; UniProt ...