Which types of nitrogenous bases are adenine and uracil, and where are they found? What enzyme matches RNA nucleotides to complementary DNA nucleotides? What will be a strand of complementary RNA for the DNA strand ATGACGGATCA? Which of the following represents a nucleotide of RNA? Phosphate-Sug...
What are DNA and RNA extractions? What are the four bases of RNA? Which one is genetic material, DNA or RNA? What is the complementary RNA strand for adenine (A)? for uracil (U)? for guanine (G)? for cytosine (C)? Which molecule is not found in DNA? a. uracil b. guanine c....
a) cytosine b) thymine c) guanineWhich of the following is a pyrimidine in DNA? (a) Cytosine (b) Adenine (c) Guanine (d) Uracil.Which bases are found in a strand of DNA?Which bases are found in DNA and RNA?Which of the following pairs with adenine in a DNA molecule? a...
Rimac represents a student model as a regression equation, implemented using Instructional Factor Analysis Model (IFM), as proposed by Chi et al. (2011). The system starts with a default stereotypical model for low, medium, and high prior knowledge students, classifies the student into one of ...
The underlined portion represents a sequence comprising N-terminal side cysteine-1 to C-terminal side cysteine-10, which is the minimal CRD region (SEQ ID NO: 21). SEQ ID NO: 21: CQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPEL RFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERL...
DNA and RNA are those genetic species through which one can analyze various characteristics of a living organism. RNA is made from a single-strand and the DNA possesses a double helix. Answer and Explanation: Learn more about this topic: ...
The ___ of a gene encodes information for RNA polymerase, such as where to bind and which DNA strand to read. Gene: Eukaryotic genes have a well-defined structure. Most eukaryotic genes will have regulatory sequences which will consist of, enhancers or...
Which of the following pairings regarding protein structure is/are incorrect? a) primary structure: alpha helix b) quaternary structure: hydrophobic interactions between different regions of the same polypeptide strand c) tertiary structure: interactions What are the building blocks that we use to pro...
What is an anticodon of the transfer RNA for valine? What is the shortest peptide in mRNA? What are the first six nucleotides of mRNA if the sequence below represents the first cDNA strand? 5' TACGGCTATCCCTACGCCT 3' (a) 5'UGGCGA3' (b) 5'UACGGC3' (c) 5'AUGCCG3' (d) 5'A...
What are the four nitrogenous bases found in RNA? What are the pairings for the bases in RNA and DNA? Does adenine pair with uracil in RNA? If the upper strand of the DNA molecule below acts as a template to make mRNA, what is the nucleotide What sequence of bases would pair with ...