LONG-term potentiation (LTP) refers to a persisting enhancement of neurotransmission that follows high-frequency activation of certain synapses 1 . Although both pre- and postsynaptic mechanisms contribute to LTP 2,3 , it is believed that the enhanced release of neurotransmitter that accompanies this ...
LLong-Term PotentiationAndroulla Ioannou andXenia Anastassiou-HadjicharalambousUniversity of Nicosia, Nicosia, CyprusDefinitionLong-term potentiation refers to the persistentincrease in synaptic strength following high-frequency stimulation of a chemical synapse.IntroductionLong-term potentiation of synaptic ...
As mentioned above, long-lasting long-term potentiation (LTP) is used as a model paradigm to examine the cellular neurophysiological events that may underlie memory formation. As with memory formation, LTP can be broken into temporally and mechanistically distinct components; long-lasting LTP (L-LTP...
The result of LTP is the strengthening of neuronal synapses through increased receptor density on the post-synaptic cell and the expression of growth genes. One of the most studied signaling pathways related to long-term potentiation and memory consolidation is the protein kinase A (PKA) pathway. ...
We propose that the latter phenomenon is due to a low priming probability. Our results also explain the effect of paired pre- and postsynaptic activity on STD. In neocortical pyramid-pyramid synapses pairing induces a form of long-term potentiation that has been described as a redistribution of ...
Pedosiaittievsetastteims fuolri that lead to increasing conductance represent excitatory actions, and the following negative stimuli represent inhibitions. Achievement of the input-dependent enhancement of synaptic weight is of popular interest, such as post-tetanic-potentiation (PTP), short-term memory...
Input specificity refers to the observation that when a tetanus (or another induction protocol) is applied to one of two (or more) inputs converging on the same post-synaptic target then the potentiation is only observed at the tetanised input. The synaptic strength at the untetanised input(...
It is generally believed that late-phase long-term potentiation (L-LTP) and long-term memory (LTM) require new protein synthesis. Although the full complem... Y Lu,K Christian,L Bai - 《Neurobiology of Learning & Memory》 被引量: 1275发表: 2008年 Transcription Factors in Long-Term Memory...
States of reduced interference, in which no new memories are encoded following learning, have been found to facilitate memory consolidation. These states include slow-wave sleep, inhibited long-term potentiation using NMDA antagonists or other amnesia-inducing drugs, or short periods of wakeful ...
long-termpotentiation;short-termpotentiation;associative;hippocampus;neocortex;pyramidalLong-termchangesinsynapticefficacyhavebeenproposedtounderlievariousformsoflearningandofcorticalreorganization.Ingeneral,theseproposalsassumethataformofassociativelong-termpotentiation(LTP)producesanincreaseinthegainofasynapse.Thatis,...