Official answer: Any drug that is classified as an "opioid" can cause constipation. Examples of commonly prescribed opioids...
Provigil (modafinil) is a stimulant drug, which means it activates the nervous system. Provigil was approved by U.S. the Food and Drug Administration (FDA) in 1998. The drug is approved to help promote wakefulness in adults with the followingsleep disorders:1 Narcolepsy, or excessive sleepiness...
Biological Motives: The biological motives are approximately equivalent to the primary reinforcers, in each case consisting of those needs that animals pursue out of a molecular necessity, such as to fuel up on fats with some salt or protein, plus water. Answe...
1. A method of treating a disorder or disease of a mammal, selected from Parkinsonism, drug addiction and abuse, and depression, which disorder or disease is responsive to the inhibition of dopamine reuptake, comprising the step of administering to such a mammal in need thereof an effective amo...
Physicianspecialty—AphysicianspecialtyisanyspecificbranchofmedicineinwhichaphysicianmayconcentrateDataarebasedonphysicianselfreportsoftheirprimaryareaofspecialtyPhysiciandataarebroadlycategorizedintotwoareasofpracticegeneralistsandspecialistsPrimarycaregeneralistspracticeinthegeneralfieldsoffamilyandgeneralpracticegeneralinternalmedi...