Nonreactive (negative). This means you're not currently infected with hep C. If you think you've been exposed within the last 6 months, you will need to be tested again to make sure because it can take a while for your antibody levels to rise high enough to be detected on a test....
Reactive (positive). This means that you have been infected with hep C at some point, but you may not be currently infected. Your immune system may have fought off the virus on its own without treatment. If you're positive or think you've been exposed to the hep C virus within in pa...
4.3. Non-HDL-C Non-HDL-C serves as a marker for the cholesterol content of atherogenic ApoB-containing lipoproteins, although it does not account for the number of these particles. Serum non-HDL-C can be calculated using the following formula: non-HDL-C = Total cholesterol − HDL-C. ...
Antioxidant activity of bio-AgNPs refers to the formation of non-reactive stable radicals through an inhibition of the oxidation of molecules by preventing the initiation step of the oxidative chain reaction. The antioxidant potential of bio-AgNPs depends on the properties of various molecules ...
α-CTx ImI does not have the typical α-helical region found in the other α-CTxs used in this study, so the α-helical content was not calculated for this sample. However, the CD spectrum of α-CTx ImI did indicate a change in secondary structure upon treatment with Contrex™ EZ. ...
tomwvieytcoahwfimbayyreorfsaibd(ribaelsluly(eba)lu.nedA).afAtreefrtreetrphtlehayecyehdhaabvvyeefarresetcc-eteiwviveitdechdthmtehusesigcslneiaglp,nrteahcleu, rtsshlooewr scpelolrlewsc(ulprigsrohertcursor cells (light blupeu) rmpleo)vtheaat wdifafeyrernatdiaitaelilnyreasnpdonaseretorHepHla...