Thinking about studying law in the UK? Explore our live prospectus made by our current University of Law students for the facts that won’t fit into a booklet.
Financial Services Law, Regulation and Compliance (Top-up) LL.M. / Part-time / Online London Metropolitan University Online 8000 GBP / year 1 year Featured Legal Practice (SQE1 and 2) LL.M. / Full-time, Part-time / Online, On campus London Metropolitan University London, United Kin...
Online Construction Project Management, MSc Online International Relations, MA Online Master of Business Administration, MBA Online MBA with Data Analytics, MBA P Performance Analysis, MRes Performance Nutrition, MRes PGCert Advanced Legal Skills: SQE 2 Preparation Course (Law), PG Cert, Prof...
R.QRESSQEQSSVVR.A− (SEQ ID NO: 47) K.YGKDSCQGDSGGPLVCGDHLR.G− (SEQ ID NO: 48) R.AVIHPDYDAASHDQDIMLLR.L− (SEQ ID NO: 49) Protein: Kininogen-1 (SwissProt Accession number P01042)
A*-Th/L-CTLKQIINMWQVVGKAMYA-GPKEPFRDYVDRFYKTLRAEQASQEVKNWMTA2,A202,A5,A24, A2402,A25,A26,A33, B7,B8,B12,B14,B35, B39,B44,B52, B53Bw62,B27,B2705, B57,B5701,B70,B71, Bw62,Cw3,Cw8,Cw0401 A*-Th/M-CTLKQIINMWQVVGKAMYA-A1,A2,A3,A3.1,A03, ...
This book analyses he implementation of the United Nations Convention on the Law of the Sea (UNCLOS) in the light of state practices of China and Japan. The special character of the book can be found in its structure of comparative analysis of the practices of China and Japan in each part...
KVGKFMAKLA EHMFPKSQE Preferably, both extracellular domains of ARMCX-3 are used as a biomarker of senescent cells. The amino acid sequence of the first extracellular domain of ARMCX-3 is referred to herein as SEQ ID No. 9, as follows: ...
Disclosed are nucleic acid molecules, and methods of their use, which have a specific structure including a double helical domain and a G-quadruplex domain physically connected by a
Disclosed are nucleic acid molecules, and methods of their use, which have a specific structure including a double helical domain and a G-quadruplex domain physically connected by a
2. The fusion protein of claim 1, wherein the guide nucleotide sequence-programmable RNA binding protein is selected from: Cas9, modified Cas9, Cas13a, Cas13b, CasRX/Cas13d, and a biological equivalent of each thereof. 3. The fusion protein of claim 2, wherein the guide nucleotide sequence...