RGKDIRCCVEHMQADWRTVKREKDQQVMLKSAKFGRYVTASTAAFMQGGVFCYCFMTALSTEVIQVGNETRIVHQLPYVTYKELIDINESP TNEIILFMQFLTGFIVSSSTLGILSITVVLIAHACGQLNVVMTWITEFVNESRKEKIAPFENIGIIVERHLRTLSFVSSIEETVNRIFFLEVLRSTLHM CMLSYYIVTEWSDSDIQILTTYSMLLASICFNIFVICYIGETLTEQSRKVGDVVYMANWYYLTEKRILELILIIMRSSVVVEITA...
In addition, because computer navigation-assisted surgery requires the installation of fixation pins to fix the tracker, there is a risk of fracture [21–24]. Smith et al. [25] reported that during computer navigation system-assisted and robot-assisted TKA, the incidence of fractures related to...
Introduction There have been extensive studies about permutation flowshop scheduling (PFSP) in the literature with many important applications in manufacturing and service systems [1–4]. The traditional PFSP is concerned with scheduling n jobs through m machines in such a way that the same sequence...