Current Limit CS settling time from IN rising edge = 2 A. From VENx rising edge to 90% of VCS. Multi-sense transition delay from channel to channel VDIAG_EN = 5 V, current sense output delay when multi-sense pins SEL and SEH transition from channel to channel 0.1 0.3 30 50 www.ti...
RGKDIRCCVEHMQADWRTVKREKDQQVMLKSAKFGRYVTASTAAFMQGGVFCYCFMTALSTEVIQVGNETRIVHQLPYVTYKELIDINESP TNEIILFMQFLTGFIVSSSTLGILSITVVLIAHACGQLNVVMTWITEFVNESRKEKIAPFENIGIIVERHLRTLSFVSSIEETVNRIFFLEVLRSTLHM CMLSYYIVTEWSDSDIQILTTYSMLLASICFNIFVICYIGETLTEQSRKVGDVVYMANWYYLTEKRILELILIIMRSSVVVEIT...
Introduction There have been extensive studies about permutation flowshop scheduling (PFSP) in the literature with many important applications in manufacturing and service systems [1–4]. The traditional PFSP is concerned with scheduling n jobs through m machines in such a way that the same sequence...