The degree of sequence identity between 2 nucleotide sequences Segen's Medical Dictionary. © 2012 Farlex, Inc. All rights reserved. Want to thank TFD for its existence?Tell a friend about us, add a link to this page, or visitthe webmaster's page for free fun content. ...
This Perspective focuses on two genomic enzymology web tools that assist the discovery novel metabolic pathways: (1) Enzyme Function Initiative-Enzyme Similarity Tool (EFI-EST) for generating sequence similarity networks to visualize and ... Gerlt,A John - 《Biochemistry》 被引量: 4发表: 2017年...
Target: 81 EVAKDADLVIEAIPE--IFDLKKKVFSEIEQYCP 112 |*||***||*|**|* **|***|***|***| Query: 170 EEAKNLGLVAEVFPQERFWDEVMKLAREVAELPP 203 Length: 34 Identity: 11/34 (32.4%) Similarity: 32/34 (94.1%) Gaps: 2/34 ( 5.9%) Score: 37 SAM...
as well as defining the cluster cut-off through a biologically comprehensible parameter known as the sequence identity thresholdT. The value ofTranges from 0 (complete
Review Enzyme Function Initiative-Enzyme Similarity Tool (EFI-EST): A web tool for generating protein sequence similarity networks John A. Gerlta,b,c,⁎, Jason T. Bouviera,b, Daniel B. Davidsona, Heidi J. Imkera, Boris Sadkhina, David R. Slatera, Katie L. Whalena aInstitute for Gen...
which had two variants with 85.9% similarity between them. 22/27 strains contained onesrtAvariant (WP_046390884.1) while 5/27 strains contained another (WP_037592200.1). This was the result of the 90% identity cut-off criteria used in the pangenome analysis. Within this constraint, sortasesrt...
(max. 20 kb per missing telomere). Overall, the four pseudo-haplotypes share a sequence identity of 96% as assessed by dnadiff [52]. The genome has an overall GC content of 28.3%, and repeated regions make up roughly 50%. To date, assembled microsporidian genomes range from 2.3 Mb (E...
in the intronic region between exon 3 and exon 4 (data not shown). The successfully sequenced regions comprised between 9.6% and 94.4% of the amplicon, although those regions uniformly had a high percent identity with therspo1genomic reference (98.1% - 100% pairwise percent identity) from two...
Acting upon target stimuli from the environment becomes faster when the targets are preceded by a warning (alerting) cue. Accordingly, alerting is often used to support action in safety-critical contexts (e.g., honking to alert others of a traffic situat
Sequence identifiers link to many additional resources within SeqHound such as taxonomy, MEDLINE, MMDB, VAST domains, GO, LocusLink, CDD and OMIM. Additionally, the sequences are inter-linked based on sequence identity, on sequence similarity, on links between DNA and proteins as implied by codi...