coli ML35p, MIC = 1.1 µM against Listeria monocytogenes EGD, and MIC = 0.9 µM against methicillin-resistant Staphylococcus aureus (MRSA) ATCC 33591. Meanwhile, Ac2 (SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLR) presented MIC of 0.3 µM against E. coli, MIC = 1 ...
against a combinatorial ampeptod library, from which five ampeptod candidates were identified and their antibacterial potencies against two clinical bacterial strains, that is, Staphylococcus aureus ATCC33591 and Pseudomonas aeruginosa ATCC27853, were measured using a standard microtiter broth dilution ...
aureus ATCC 43300, ATCC 33591) activities with MIC values ranging from 3.13–6.25 μg/mL (Chen et al., 2017). A known compound 1-(2,6-dihydroxyphenyl)butan-1-one (62) (Fig. 5) isolated from the endophytic fungus Penicillium citrinum HL-5126 inhabiting inside Brguiera sexangula var. ...
ETX0914 was efficacious in vivo against clinical isolates of S. aureus PK/PD magnitudes for ETX0914 were determined in the neutropenenic mouse thigh infection model48 using four S. aureus strains: MSSA ARC516, MRSA ATCC33591, USA100 NRS382 and USA300 NR538 (Table S5). USA100 and USA300...
A series of alkyl gallates was found to show antibacterial activity against Gram-positive bacteria including methicillin resistant Staphylococcus aureus (MRSA) strains. For example, dodecyl gallate exhibited bactericidal activity against MRSA ATCC 33591 strain with an MBC of 74 μM. The time–kill cur...
HG2 and HG4 had antibacterial activity mostly against Gram-positive pathogens, and were most potent against methicillin-resistant Staphylococcus aureus (MRSA) strains (Table 2). HG2 had a MIC range of 16–32 µg/ml, while HG4's MIC was 32–64 µg/ml, depending on the MRSA strain and...
against a combinatorial ampeptod library, from which five ampeptod candidates were identified and their antibacterial potencies against two clinical bacterial strains, that is, Staphylococcus aureus ATCC33591 and Pseudomonas aeruginosa ATCC27853, were measured using a standard microtiter broth dilution ...
Rap–Stoermer condensation of 5,7-dibromosalicylaldehyde with diverse phenacyl bromides and evaluated for in-vitro antibacterial activities against methicillin-sensitive Staphylococcus aureus (MSSA) ATCC 29213, methicillin-resistant Staphylococcus aureus (MRSA) ATCC 43300, and MRSA ATCC 33591 by agar ...
aureus (MSSA; ATCC 6538) and methicillin resistant S. aureus (MRSA, Xen 31; parental strain ATCC 33591). Minimum inhibitory concentration (MIC) assay was performed for individual or combination peptides. Microtiter plate was prepared with GakA, GakB, GakC, GakA+GakB, GakB+GakC, GakA+GakC...
aureus ATCC 33591 and multidrug‐resistant Escherichia coli ATCC BAA6 at higher concentrations. The bactericidal time–kill kinetics test illustrated that compound 5k had rapid bactericidal potential. Docking results exhibited that compound 5k showed various kinds of binding to the FabH receptor, ...