Category: S0J, SK, Debden City Type: D Latitude: 53.526699999999998 Longitude: -106.8813 Postcode: S0J 0S0 Province Code: SK City: Debden ID: 559881 Province: Saskatchewan Click here to buy Canada Postcode Database More Links S0J 0J0 S0J 0K0 S0J 0L0 S0J 0M0 S0J 0N0 S0J 0S0 ...
Province Code: MB City:Elphinstone ID: 536391 Province:Manitoba Click here to buy Canada Postcode Database More Links R0J 0G0 R0J 0J0 R0J 0K0 R0J 0L0 R0J 0M0 R0J 0N0 R0J 0P0 R0J 0R0 R0J 0S0 R0J 0T0 R0J 0V0 ‹ previous|next › ...
yesntputrederyf,e3ar9.n0Td2htheMepifrliowngaarluaekmxeaewmSiltl(.ion4pc:e0lun0d-oberoao5llk:0s)0tiuspdtmyakmsetanatreitnrdiaivlsidyuoaully July 18 soensli nsieo.nsP,lbeuatsaetNtseiongndn-aPunrpcoeftiotisdMnaaoyitlaimntgawsnwSdwaemt.omirnyaa.dr,Sis1eo1sn:s0pi0oc-nc1s.2ca:o3rem0 ...
Apparatus for assisting in merging postal articles with a stack of mailpieces that have already been sorted into a certain sequence, said apparatus comprising a merge table suitable for storing the stack of mailpieces on edge, a first camera suitable for forming a digital image of a current pos...
Province Code: QC City:Richelain ID: 199885 Province:Quebec Click here to buy Canada Postcode Database More Links J0J 1K0 J0J 1L0 J0J 1M0 J0J 1N0 J0J 1P0 J0J 1R0 J0J 1S0 J0J 1T0 J0J 1V0 J0J 1W0 J0J 1X0 ‹ previous|next › ...
City Type: D Latitude:48.4407 Longitude:-68.523399999999995 Postcode:G0H 1R0 Province Code: QC City:Riviere-Pentecote ID: 84461 Province:Quebec Cliquez ici pour acheter Canada Base de Données de Code Postal Exemple d'Enveloppe Pour plus d'explications, veuillez lire le document officiel:CAN.pdf....
Province Code: BC City:Germansen Landing ID: 653506 Province:British Columbia Click here to buy Canada Postcode Database More Links V0J 1L0 V0J 1N0 V0J 1P0 V0J 1R0 V0J 1S0 V0J 1T0 V0J 1W0 V0J 1X0 V0J 1Y0 V0J 1Z0 ...
Postcode:V0J 1N0 Province Code: BC City:Fort Fraser ID: 653502 Province:British Columbia Click here to buy Canada Postcode Database More Links V0J 1E0 V0J 1H0 V0J 1J0 V0J 1K0 V0J 1L0 V0J 1N0 V0J 1P0 V0J 1R0 V0J 1S0 ...
Postal Code Category:V0J,BC,Fraser Lake City Type: D Latitude:54.066499999999998 Longitude:-124.8494 Postcode:V0J 1S0 Province Code: BC City:Fraser Lake ID: 653505 Province:British Columbia Click here to buy Canada Postcode Database More Links ...
Province Code: MB City:Glenella ID: 536396 Province:Manitoba Click here to buy Canada Postcode Database More Links R0J 0N0 R0J 0P0 R0J 0R0 R0J 0S0 R0J 0T0 R0J 0V0 R0J 0X0 R0J 0Y0 R0J 0Z0 R0J 1A0 R0J 1B0 ‹ previous|next › ...