Supports any ASCII text based genome such as FASTA, GBK, .txt, .gff etc, if it has text like GTAGCCTAGTCGATTCAG or maybe UUGCUTGUTGUTGUTGTUCUT then AminoSee can render up a set of images of it! The triplet for Lyson AAA would render to this indigo colour at 313 A node command ...
caecnctoargdeing to share of parctiiecsu/tlyarpseus bosfphecoineWes/yabtyledpe'essatoersfethnaootntpesy≤ibg0ene.i0sf5ica.arSenotnmlyoetdsbiifgefenekrifienceaptneatrmlsyocdnoiugffledriehfnfaetvraemnmtoanepngitadiorinyffeesdriezmnetso,arpaeciacthroyardnsiinzoegnse,toahcocnoerydbinege tsou...