https://doi.org/10.1093/bfgp/elae004. Article PubMed Google Scholar Guo L, Tang J, Tang M, et al. Reactive oxygen species are regulated by immune deficiency and Toll pathways in determining the host specificity of honeybee gut bacteria. Proc Natl Acad Sci. 2023;120(33): e2219634120....
et al. Report on the CD33 cluster workshop:biochemical and genetic characterization of gp67. In: Knapp W, Dorken B., Gilks W R, et al., eds. Leucocyte typingIV: White Cell Differentiation Antigens. 1st ed. Oxford, England: Oxford University Press, 1989: 814-816. Porgador A. et ...
These prodrug nanoparticles exhibited MMP-2 dependent cellular uptake, P-gp inhibiting ability and high antitumor activity to both drug sensitive and resistant cancer cell lines. MMP-2-sensitive PEG-pp-PF14/DNA complexes exhibited specific induction of gene expression in a subcutaneous Neuro2a tumor ...
followed by the peptide hormone adipokinetic hormone, AKH (Stone et al.1976) a year later. It is noteworthy that although proctolin is a pentapeptide (RYLPT) in those days it required 125,000 cockroaches (125 kg fresh weight) to purify enough material for sequencing....
A synthetic peptide from HIV-1 gp41 is a potent inhibitor of virus-mediated cell-cell fusion. AIDS Res. Hum. Retroviruses 9, 1051–1053 (1993). Article CAS PubMed Google Scholar Bruckdorfer, T., Marder, O. & Albericio, F. From production of peptides in milligram amounts for research...
Finally, a defensin-like peptide P9R (NGAICWGPCPTAFRQIGNCGRFRVRCCRIR) displayed excellent activity against pH dependent viruses (IC50 of 0.26 nM).40 The availability of high-resolution structural information has facilitated this approach, by identifying the key ...
which mainly act as agonists97,98,99,100. In addition, peptides targeting transforming growth factor (TGF)-β1101or epidermal growth factor receptor (EGFR)102, and peptide antagonists that disrupt the fibroblast growth factor (FGF)-1-FGFR1 interaction103are good examples of peptide drugs discovered...
Peptides are a kind of compounds formed by α-amino acids linked together by peptide bonds, which are also intermediate products of protein hydrolysis. Nowadays, they mostly come form laboratory chemical synthesis and protein degradation. Peptides are important in maintaining the normal functioning of...
( ) Structure-affinity relationships in the gp41 ELDKWA epitope for the HIV-1 neutralizing monoclonal antibody 2F5: effects of side-chain and backbone modifications and conformational constraints, J. Peptide Res. 59, 2002 / 264-276. Toyoda, Kazunori et al (1997) Effect of Aging on ...
TM, or gp41, contains the transmembrane anchor domain responsible for anchoring the envelope protein of the virion into membranes, as well as the fusion domain which is responsible for entry into cells through fusion of the viral and cellular lipid membranes. TM contains several additional ...