Cross‐couplingPalladiumHomogeneous catalysisHaloalkenesStereoselective reactionsThe regio- and stereoselectivity of the palladium-catalysed cross-coupling reactions of indium organometallics withstereodefined 1-haloalkenes and 1,1-dihaloalkenes have been studied. Triorganoindium reagents (R3In; R = alkyl,...
W. "Palladium-catalysed cross-coupling reactions in the synthesis of some high polarizability materials" Liq. Cryst., 14(1993), 741-761.HIRD M,TOYNE K J.Palladium-Catalysed Cross-Coupling Reactions in the Synthesis of Some High Polarizability Materials. Liquid Crystals . 1993...
The Sonogashira cross-coupling of acetylenes holds a prominent position among the suite of catalytic cross-coupling reactions that are key to modern synthesis. Here we present a method that is complementary to the Sonogashira reaction, demonstrating cross-coupling of lithium acetylides with aryl ...
Reactionsof Organoboron Compounds andTheirMechanism 2460 A. Cross-Coupling Reaction2460 B.Other Catalytic Process by Transition-Metal Complexes 2464 IV. Cross-Coupling Reaction2465 A. Coupling of 1-Alkenylboron Derivatives: Synthesis of Conjugated Dienes 2465 B. Coupling of Arylboron Derivatives: ...
Transition metal-catalysed cross-coupling is one of the most powerful synthetic methods and has led to vast improvements in the synthesis of pharmaceuticals, agrochemicals and precursors for materials chemistry. A major advance in cross-coupling over the
Cross-coupling reactions of monosubstituted acetylenes and aryl halides catalyzed by palladium on charcoal. De la Rosa M A,Velarde E,Guzmàn A. Synthetic Communications . 1990De la Rosa et al., "Cross-coupling Reactions of Monosubstituted Acetylenes and Aryl Halides Catalyzed by Palladium on ...
Chapters Languages 0:04Overview 0:51Principles of Palladium-Catalyzed Cross-Coupling Reactions 2:52Heck Coupling Reaction 3:52Isolation and Purification of Heck Coupling Product 4:46Applications 6:03SummaryOverview Principles Procedure Results Applications and Summary Transcript Automatic Translation ...
Kumar et al., Palladium Catalyzed Cross-Coupling Reactions for the Synthesis of 2.5-disubstitutedfurans, Hetercyclic Comm. 5:301-304 (1999).Kumar A, Stephens CE, Boykin DW. Palladium catalyzed cross-coupling reactions for the synthesis of 2,5-disubstituted furans. Heterocycl Commun. 1999; 5:...
ChemInform Abstract: Palladium-Catalyzed Cross-Coupling Reactions of Organoboron Compoundsorganic chemistryreviewcatalysisphase-transfer catalysis... N Miyaura,A Suzuki - 《Cheminform》 被引量: 1.6万发表: 1996年 Palladium-Catalyzed Cross-Coupling Reactions of Organoboron Compounds Norio Miyaura ' and Norio ...
Palladium-catalyzed cross-coupling reaction of organoboron compounds with organic triflatessubstitution reactionscyclopentane derivatives T Ohe,N Miyaura,A Suzuki - 《Cheminform》 被引量: 1.6万发表: 1993年 Palladium-Catalyzed Cross-Coupling Reactions of Organoboron Compounds Norio Miyaura ' and Norio Miyaura...