Publication Date: 06/28/2018 Filing Date: 06/29/2016 Export Citation: Click for automatic bibliography generation Assignee: THE ARIZONA BOARD OF REGENTS ON BEHALF OF THE UNIVERSITY OF ARIZONA JOSLIN DIABETES CENTER, INC. International Classes: C07K14/74;C07K14/725;C12N5/0783;C12N9/12 View Pa...
Moreover, antibodies of all classes are included. In addition, special antibodies, like humanized antibodies and such, are considered to be antibodies of the present invention. Antibodies that react with the LTC4 receptor of the present invention, for instance polyclonal antibodies and monoclonal ...
The collected precipitate is dissolved in 75 μL of distilled water and the following reagents are added thereto and incubated at 37° C. for 30 min. The reaction solution is treated with phenol-chloroform and RNAs are collected by ethanol precipitation.3 5× TAP buffer20 μL Tobacco acidic ...
Also, people find that many MOOC online courses are still dominated by the cognitive mode of classes, and that there is almost no interaction between teachers and students, let alone cultivating the students' learning habits of behaviorism and constructivism. Such phenomenon goes against the concept...
73 CEP350 NP_055625.3 Cell cycle Y337 KVATAPPAPAyK SEQ ID NO: 76 regulation 74 ch-TOG NP_055571.2 Cell cycle Y268 LEQQQSAGGDAEGGGDDGDEVPQIDAy SEQ ID NO: 77 regulation ELLEAVEILSK 75 HCAP- NP_071741.2 Cell cycle Y929 GNKEFGDQAEAAQDATLTTTTFQNEDE SEQ ID NO: 78 G regula...
Major classes include carcinomas which are cancers of the epithelial tissue (e.g., skin, squamous cells); sarcomas which are cancers of the connective tissue (e.g., bone, cartilage, fat, muscle, blood vessels, etc.); leukemias which are cancers of blood forming tissue (e.g., bone ...
EGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYTAPGKELSLELGGSEATPEDDPLLRTGSVFGGLVRDVRRRY PHYPSDLRDALHSQCVAAVLFIYFAALSPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGP LLVFEEAFFKFCRAQDLELYTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFYKLYKVF TEHPLLPFYPPEGALEGSLDAGLEPNGSALPPTEGPPSPRNQPNTALLSLILMLGTFFIAF...