Export Citation: Click for automatic bibliography generation Assignee: THE ARIZONA BOARD OF REGENTS ON BEHALF OF THE UNIVERSITY OF ARIZONA JOSLIN DIABETES CENTER, INC. International Classes: C07K14/74;C07K14/725;C12N5/0783;C12N9/12 View Patent Images: Download PDF 20180179260 Primary Examiner: SKE...
Moreover, antibodies of all classes are included. In addition, special antibodies, like humanized antibodies and such, are considered to be antibodies of the present invention. Antibodies that react with the LTC4 receptor of the present invention, for instance polyclonal antibodies and monoclonal ...
Wakamatsu, Ai (Kisarazu-shi, JP) Application Number: 10/790414 Publication Date: 08/12/2004 Filing Date: 03/01/2004 Export Citation: Click for automatic bibliography generation Assignee: Taisho Pharmaceutical Co., Ltd. Primary Class: 435/6.12 International Classes: C12N15/10; (IPC1-7): C12Q1...
Also, people find that many MOOC online courses are still dominated by the cognitive mode of classes, and that there is almost no interaction between teachers and students, let alone cultivating the students' learning habits of behaviorism and constructivism. Such phenomenon goes against the concept...
As such, it represent a paradigm leading the way for many other programs seeking to address many classes of diseases (See, Harrison's Principles of Internal Medicine, McGraw-Hill, New York, N.Y.). Most varieties of leukemia are generally characterized by genetic alterations e.g., chromosomal...
EGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYTAPGKELSLELGGSEATPEDDPLLRTGSVFGGLVRDVRRRY PHYPSDLRDALHSQCVAAVLFIYFAALSPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGP LLVFEEAFFKFCRAQDLELYTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFYKLYKVF TEHPLLPFYPPEGALEGSLDAGLEPNGSALPPTEGPPSPRNQPNTALLSLILMLGTFFIAF...
Major classes include carcinomas which are cancers of the epithelial tissue (e.g., skin, squamous cells); sarcomas which are cancers of the connective tissue (e.g., bone, cartilage, fat, muscle, blood vessels, etc.); leukemias which are cancers of blood forming tissue (e.g., bone ...