Previous co-crystal structures of Pf- and PvAMA1 reveal a hydrophobic binding pocket on AMA1 that interacts with the extracellular RON2-loop23,26,45,58. Visually, our co-crystallization structure of humAb 826827 with PvAMA1 indicates that this antibody may interact with the same PvAMA1 residues...
Accordingly, the present invention relates to an isolated and/or purified monoclonal antibody which can bind to the MAP protein or its binding subdomains, including the Map10 protein, and which thus can be useful in methods of preventing and treating staphylococcal infection when used in amounts e...
(yukinarikato@ med.tohoku.ac.jp; yukinari-k@bea.hi-ho. ne.jp) A Cancer-specific Monoclonal Antibody Recognizes the Aberrantly Glycosylated Podoplanin Yukinari Kato & Mika Kato Kaneko Department of Regional Innovation, Tohoku University Graduate School of Medicine, 2-1 Seiryo-machi, Aoba-ku, ...
HUMAN MONOCLONAL ANTIBODY THAT JOINS EP-CAM AND ITS USE IN THE THERAPY DELCANCER.Human monoclonal antibody that can bind to human Ep-CAM characterized in that the antibody comprises: a). a heavy chain CDR1 region having the GGTFSSY amino acid sequence, a heavy chain CDR2 region having the...
The genes encoding the scFvs from five of the obtained selection outputs (representing different cross-panning strategies) were PCR amplified using M13leadseq (AAATTATTATTCGCAATTCCTTTGGTTGTTCCT) and Notmycseq (GGCCCCATTCAGATCCTCTTCTGAGATGAG) primers and subcloned into the pSANG10-3F expression ...
1. Field of the Invention Human Monoclonal Antibody Specifically Binding to Surface Antigen of Cancer Cell Membrane The present invention relates to a novel human monoclonal antibody useful for diagnosis and therapy of cancer, an isolated DNA encoding the monoclonal antibody, and a hybridoma producing...
antibody variable-region genes were recovered from single cells by reverse transcription (RT)-PCR using heavy and light chain variable- region-specific primers. The following PCR primers were used: CTGGTTTCCAGGCACCAGGTGTGACATCCAGATGACCCAGTCTCC (VK primary forward); CTTTCATATTCAACCTTGGTCAAC (VK ...
OPEN SUBJECT AREAS: VIRAL INFECTION ANTIBODY THERAPY Received 28 September 2014 Accepted 7 October 2014 Published 6 November 2014 Correspondence and requests for materials should be addressed to X.Q. (xiangguo.qiu@ phac-aspc.gc.ca) Molecular Characterization of the Monoclonal Antibodies Composing ZM...
Table 1: Selected mAb-specific peptides. ProteinPeptide sequenceIg chain m/z z HCD collision energy, % Daratumumab GLEWVSAISGSGGGTYYADSVK IgG-HC 735.3551 3 30 Nivolumab ASGITFSNSGMHWVR IgG-HC 825.3963 2 28 IgG-kappaM-protein pt 1 APNLLLYDASNLEAGVPSR IgG-HC 1,000.5260 2 28 EWVAVAVLYYD...
The sequence of the said antibody is shown in Table 1 and Sequence Listing. TABLE 1 Sequence of the antibody Clone ID SEQ ID NO Amino acid sequence 1H6 Heavy chain 1 QVQLVQSGAEVKKPGSSVKVSCKASGFTFTTYYISW VRQAPGQGLEYLGYINMGSGGTNYNEKFKGRVTITA DKSTSTAYMELSSLRSEDTAV...