(1988a) Production of monoclonal antibody to characterize the antigen of Paragonimus westermani. Parasitol. Res. 75, 144-147.H. Sugiyama,H. Hinoue,J. Katahira,T. Horiuchi,T. Tomimura,Y. Kamata,S. Kozaki.Production of monoclonal antibody to characterize the antigen ofParagonimus westermani[J]....
PART1 MONOCLONALANTIBODIES(m-Abs),AREAbsWHICHAREGENERATEDBYEXPANDINGANDIMMORTALIZINGSINGLECLONESOFB-CELLS,EACHOFWHICHHASADEFINEDSPECIFICITY.WHATISMONOCLONALANTIBODY?PART2 BECAUSEOFTHEDEFINEDSPECIFICITYTHEmAbsRECOGNIZEJUSTONEONLYEPITOPEONTHEANTIGEN. THEMONOCLONALAbsWHICHDERIVEDFROMONECLONEAREALMOSTOFASINGLEISOTYPEHOWWE...
monoclonalantibody 系统标签: monoclonalantibodymyelomalymphocytesantibodiesdisulfide MONOCLONALANTIBODYRongzhuRongzhuFortheoriesconcerningthespecificityindevelopmentFortheoriesconcerningthespecificityindevelopmentandcontroloftheimmunesystemandthediscoveryofandcontroloftheimmunesystemandthediscoveryoftheprincipleforproductionofmonoclonal...
related to deficient normal immunoglobulins/antibody production and/or cell-mediated immunity ? bacterial, viral, etc. (frequently pneumonia) ? Symptoms of renal failure (20-30%) ? nephrotic syndrome – in associated with AL amyloidosis and with B-J-proteinuria ? Hypercalcaemia (20-30%) ?
These modi?cations vary from those that change the number of charge residues on the surface of the protein to those being less connected to the charge but can change antibody conformation. Deamidation, for example, is one possible modi?cation which is likely to have an effect on retention of...
Here we describe a human therapeutic antibody 264RAD, which binds and inhibits αvβ6 integrin function. 264RAD cross-reacts with human, mouse and cynomolgus monkey αvβ6, and inhibits binding to all ligands including the latency-associated peptide of TGF-β. Screening across a range of ...
production of reticulocytes followed by a higher maintenance dose that resulted in sustained serum antibody levels.27Piccioneet al.36proposed that an alternative approach to targeting CD47 could be to generate a bispecific antibody that combines a monovalent CD47 targeting arm with a tumor-specific ...
2000. Characterization of the porcine gammadelta T-cell receptor structure and cellular distribution by monoclo- nal antibody PPT27. Immunology 99:504-509.Yang, H. & Parkhouse, R. M. (2000) Characterization of the porcine gammadelta T-cell receptor structure and cellular distribution by ...
Campath-1H monoclonal antibody therapy. Curr Opin Oncol 2000;12:574 - 81.Flynn JM, Byrd JC. Campath-1H monoclonal anti- body therapy. Curr Opin Oncol. 2000;12:574-581.Flynn JM, Byrd JC. Campath-1H monoclonal antibody therapy. Curr Opin Oncol. Vol. 12; 2000:574-581...
Monoclonal antibody DOG1.1 shows higher sensitivity than KIT in the diagnosis of gastrointestinal stromal tumors,including unusual subtypes. Liegl B,Homick JL,Corless CL,et al. The American Journal of Surgical Pathology . 2009LIEGL B,HORNICK JL,CORLESS CL...