Royalty-fri videoer SitronDrikkeCocktail 4K00:54 JordbærFruktOrganisk HD00:09 PastaMatSpise HD00:10 EggMatProtein 4K00:10 JordbærBærFrukt 4K00:13 EpleFruktTreEpletre 4K00:20 FeltetHveteGrønnVår 4K00:24 GlassVannSitronvann ...
3 kommentarer Samfunnet vil gjerne høre fra deg! Logg på eller registrer deg på Pixabay for å vise kommentarer tomaterfruktmatfriskhetvelsmakendesalatpomodoroproduktivitettimerfersksunnvegetarianergrønnsakorganiskveggiekjøkkensmørbrødsunn mathel mattomatrødvitaminantioksidant ...
Vitamin A and carotenoids and the risk of Parkinson's disease: a systematic review and meta-analysis. Vitamin A and carotenoids are involved in signalling pathways regulating gene expression in many organs, including the brain. The dopaminergic system is a ... A Takeda,OP Nyssen,A Syed,... ...
vitamin B complexvitamins1. (1) Sixteen cases of typical megaloblastic anaemia have been treated with oral or intramuscular penicillin; they responded in the same way as do cases of similar anaemia to potent haematinics. The reticulocytes increased to the maximum expected for the blood count, ...
Also glucuronidates the biologically active form of vitamin D3, calcitriol, probably leading to its biliary transport and intestinal reabsorption (PubMed:18177842) Specific Function enzyme binding Gene Name UGT1A4 Uniprot ID P22310 Uniprot Name UDP-glucuronosyltransferase 1A4 Molecular Weight 60024.535...
Taepaiboon P, Rungsardthong U, Supaphol P (2007) Vitamin-loaded electrospun cellulose acetate nanofiber mats as transdermal and dermal therapeutic agents of vitamin A acid and vitamin E. Eur J Pharm Biopharm 67:387–397. https://doi.org/10.1016/j.ejpb.2007.03.018 Article CAS PubMed Google...
S-adenosylmethionine prevents oxidative stress and modulates glutathione metabolism in TgCRND8 mice fed a B-vitamin deficient diet J. Alzheimers. Dis., 20 (2010), pp. 997-1002 View in ScopusGoogle Scholar 44 H.Q. Wang, Z.X. Du, B.Q. Liu, Y.Y. Gao, X. Meng, Y. Guan, H.Y. Zh...
Vitamin C nutrition in cases of haematemesis and melaena. Thirteen out of 15 patients who had recently had haematemesis and melaena were investigated in the Bispebjerg Hospital, Copenhagen, and found to be in a co... S Lazarus - 《British Medical Journal》 被引量: 4发表: 1937年 Testing...
25-Hydroxy Vitamin D RIA Millipore-AA35F1L1 Assay Service BAP ELISA Assay Millipore-BAP8012L1 Human Endothelin-1 ELISA Millipore-BBE5L1 Human Cancer Biomarker 6-Plex Millipore-BCBP06L1X Beadlyte Human Isotyping Panel 3-Plex Millipore-BHISO03L1X Canine Gut Hormone Panel 1-plex Millipore...
energy efficiency, reduced oxidation, customisation, and hygienic process [82]. Asiimwe and team optimised the CHD to study drying kinetics of passion fruit puree [83]. They studied retention of vitamin C, B-carotene, antioxidant activity and total phenol content by 90.2, 75.9, 89.7 and 88.3%...