Each year, the company would record a depreciation expense of $10,000 and reduce the value of the equipment by the same amount. At the end of the first year, the WDV of the equipment would be $90,000 (the original cost of $100,000 minus the first year's depreciation of $10,000)...
The 135-km, 11,000 crores Eastern Peripheral Expressway-2 which was inaugurated recently by the Prime Minister, connects towns of UP and Haryana and act as an outer ring road for the capital. It is the country's first greenfield access-controlled six lane arterial developed by NHAI. ...
The shortened amino acid sequence was fabricated as follows: MKKLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR for a protein chain of 108 amino acids. The commercially available BMP2 was purchased from R&D systems (Minneapolis, USA). ...
To regulate target gene expression, the miRNA/miRNA* duplex is loaded onto the Argonaute (Ago) protein to form the final effector complex, RNA-induced silencing complex (RISC). In RISC, only a single strand of miRNA duplex will remain as functional miRNA to interact with the target mRNA to...
In the enthalpy-porosity technique, the influence of solidification on the molten steel flow velocities is considered, through introducing a source term into the momentum conservation equation of the molten steel. The source term takes the following form: SU = (1 − f ) f3 +e Amush V −...
In the form of correlation matrix lattice, backward and forward prediction error can be expressed as: xm+1 f (t, u) = xm f (t, u) + κm+1(u)A(q, u)xmb(t, u) (25) xm+1b(t, u) = A(q, u)xmb(t, u) + κm+1(u)xm f (t, u) where, E A(q, u)xmb(t, u)...
Retroviral Gag polyproteins comprise of several domains that form the structural elements of the viral particle. Of these, the major domains are the matrix (MA), capsid (CA) and nucleocapsid (NC). The NC serves as the key player in selective gRNA packaging. It is a highly basic protein ...