9 RegisterLog in Sign up with one click: Facebook Twitter Google Share on Facebook Dictionary Thesaurus Medical Financial Encyclopedia Wikipedia Related to PROTEIN:protein diet,Protein in urine AcronymDefinition PROTEINPoverty Reduction Outcomes Through Education Innovations and Networks ...
What is the product of transcription? A) DNA B) Genes C) Protein D) RNA E) All of these are correct Relating to biology, explain the term 'reverse transcription'. Describe the basics of transcription and translation. Where in human cells does each of these processes occur?
What is the name of the process where RNA directs the assembly of amino acids into a protein chain? Can a cell make mRNA without the DNA in the nucleus? Which of the following codons can only come from a strand of RNA? a) ATG b) TGC c) Two of the...
Translation rateTranslation fidelityProtein aggregation is a phenomenon of major relevance in neurodegenerative and neuromuscular disorders, cataracts, diabetes and many other diseases. Research has unveiled that proteins also aggregate in multiple tissues during healthy aging yet, the biological and biomedical...
/product="hypothetical protein" /source="PHANOTATE" /score="-22.41946661155013" /phase="0" /translation="MAAPTPEELVSQMASRGMTITTTDASGILCLVASISECLELNYPN DECRQNAIMLWASILISANTAGRYVTSQSAPSGASQSFAYGSKPWVALYNQMKLLDSAG CTGDLVEDPDGSGKPWFAVVRGSKCK" ...
However, key differences in the mechanism of hepatic steatosis among the multiple animal models of NASH make translation of the results to human disease challenging. We found that MCP-1 did not contribute to macrovesicular steatosis in mice fed the MCD diet, in striking contrast to models of ...
To learn more about amino acids, proteins, and translation, follow these links: http://www.nature.com/scitable/course-content/Essential-of-Genetics-8/6913837 http://www.nature.com/scitable/topicpage/translation-dna-to-mrna-to-protein-393 ...
The purpose of ribosomes is to serve as sites of translation. Before they can help coordinate this task, they themselves have to be put together, because ribosomes only exist in their functional form when they are actively operating as protein-manufacturers. Under resting circumstances, ribosomes...
Protein synthesis is the process that makes new proteins for the cell. Protein synthesis has two main steps: transcription and translation. During transcription, mRNA is created and during translation, the actual proteins are made.Answer and Explanation: ...
Does ribosomal RNA make amino acids? Use the polypeptide below to construct the mRNA strand as well as the original DNA code. Peptide: MET-LYS-AGR-PHE-GLY-PRO-STOP mRNA: Template: Describe the function of RNA in the transcription and translation of a gene that encodes a protein. ...