Oncorhynchus tshawytscha (chiook salmon) csCath/CATH_ONCTS RRGKDSGGSRGSKMWGWRGRPGSRSRPGVGSGIAGASGGNHVGTLTA Antimicrobial ND (Maier et al., 2008; Scocchi et al., 2009) Gadus morhua (atlantic cod) codCath2 RRSRSGRGSGKGGRGGSRESRGSRGS RGSKGSRGGLGSTIGRNLKKRTCPVRPL Antimicrobial ND Maier et al...
Oncorhynchus tshawytscha (chiook salmon) csCath/CATH_ONCTS RRGKDSGGSRGSKMWGWRGRPGSRSRPGVGSGIAGASGGNHVGTLTA Antimicrobial ND (Maier et al., 2008; Scocchi et al., 2009) Gadus morhua (atlantic cod) codCath2 RRSRSGRGSGKGGRGGSRESRGSRGS RGSKGSRGGLGSTIGRNLKKRTCPVRPL Antimicrobial ND Maier et al...
Thalassophryne nattereri (Toadfish) TnP Venom IPRCRKMPGVKMC Anti inflammatory ND Komegae et al. (2017) Pterois volitans (lionfish) Pteroicidin-α (-CONH2) Skin FIHHIIGGLFHVGKSIHDLIR(-CONH2) Antimicrobial 1-50 μM Houyvet et al. (2018) Ictalurus punctatus (channel catfish) HbβP-...
where ΔTSC and ΔTMD are the contributions of solute atom clusters and MD features, which are calculated using eqns [20 and 24] as functions of CSC and CMD, respectively. In calculating the contribution of solute atom clusters, an empirical model, in which the TTS is proportional to the ...
Oncorhynchus tshawytscha (chiook salmon) csCath/CATH_ONCTS RRGKDSGGSRGSKMWGWRGRPGSRSRPGVGSGIAGASGGNHVGTLTA Antimicrobial ND (Maier et al., 2008; Scocchi et al., 2009) Gadus morhua (atlantic cod) codCath2 RRSRSGRGSGKGGRGGSRESRGSRGS RGSKGSRGGLGSTIGRNLKKRTCPVRPL Antimicrobial ND Maier et al...
Thus, a successful KMC model relies on appropriate estimation of the energy barriers of all possible transitions in the system. The most accurate methods, thus far, involve calculations of the barriers on the fly using the dimer method of finding potential transition paths on the potential energy...
Thalassophryne nattereri (Toadfish) TnP Venom IPRCRKMPGVKMC Anti inflammatory ND Komegae et al. (2017) Pterois volitans (lionfish) Pteroicidin-α (-CONH2) Skin FIHHIIGGLFHVGKSIHDLIR(-CONH2) Antimicrobial 1-50 μM Houyvet et al. (2018) Ictalurus punctatus (channel catfish) HbβP-...
TNFα cytokine Elisa kit Life Technologies Cat #KMC3011 Carcinoembryonic Antigen (CEA) Elisa kit Lifespan Biosciences Cat #LS-F5042 Cancer Antigen 19-9 (CA 19-9) Elisa kit Lifespan Biosciences Cat #LS-F24309 CellTiter-Glo Luminescent Cell Viability Assay Kit Promega Corporation Cat #G7572 Cell...
The K-mer distribution was estimated using KMC (version 3.0) (Kokot et al., 2017) with the parameters “-k31 -t16 -m64 -ci1 -cs10000,” and the genome size was estimated with GenomeScope (version 2.0) (Vurture et al., 2017). For de novo assembly of the Vrad_JL7 genome, we ...
Migration barriersSurface diffusionKinetic Monte Carlo (KMC) is an efficient method for studying diffusion. A limiting factor to the accuracy of KMC is the number of different migration events allowed in the simulation. Each event requires its own migration energy barrier. The calculation of these ...