3. A purified peptide that inhibits type IV collagenase having the amino acid sequence APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTFDLDQNTIETMRKPRCG NPDVANYNFFP. 4. A peptide having an amino acid sequence consisting essentially of TMRKPRCGNPDVAN or MRKPRCG. Description...
Computerized systems to accurately produce medical diagnosis has been sought for decades. Such systems may be of value for alerting clinicians to unseen epidemics in a locality or wider geographical area, help clinicians to make or verify diagnosis, and thus improve medical treatment. Machine learning...
pFriroscte, sbseifsordeeevnetleorpinedg tihneadnaitnad, tihveidsuyastlePmHaPllopwagsethweipthatHieTnMt MLRcNodteosbteocdhiescpkleady itnhtehfeodrmatsa.baFsirestto, bperfeovreenetndtaetraindgupthliecadtaiotan, athnedsoyvseterrmidael.lTohwesMthReNpaisticehnetcMkeRdNintothbeePcAhTeIcEkNedTit...
IsbWX5KkbhDMnrBzKuc4pr4XUdQDJMqKB+3Z5GliYWIWLdND0ZC3+st39kuCCJMLO8lCvERRezDUNAoaGqfQXKbmD8hUdGKpYr9AZFaGF8bdJIBDcpkE2TDM609mMU37rtG5msovpN5wvwzwYbm4YG8eRFanc5Eb3QD7IZOabFrHgDEA6ZfqsjcuC4Gg2pcFZuCMJRjIlP40peyGL0I8fNWbDWiVQqt4ztPDmBKWhMXXL/uv79bbv6+ytXdGq8Goo17Wh...