Current International Recommendations on Labour Statistics (Book Review).Reviews the book 'Current international Recommendations on labour statistics,' second edition, published by the International Labor Organization.EBSCO_bspInternational Labour Review
Computational techniques can speed up the identification of hits and accelerate the development of candidate molecules for drug discovery. Among techniques for predicting relative binding affinities, the most consistently accurate is free energy perturba
A carbohydrate-binding protein made of 121 amino acids, 12.7 kDaIt binds to the SARS-CoV spike glycoprotein, thus inhibiting viral entryPDB code: 2GTYRef: DOI: 10.1016/j.str.2006.05.017 Griffithsin SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANT...
This increase of avidity is of course most pronounced in cases with a high density of both target receptors on the tumor cell surface, as in such cases, a concomitant binding of both peptides to their target receptors can take place (Figure 4A). This results in tighter binding, increased ...
Cryo-EM structure of rat P2X7 (pdb code: 6u9w) [40] embedded in a lipid bilayer, represented as spheres. The two nucleotide-binding sites, ATP and GDP, are indicated. (B). Ribbon representation of the same view, highlighting relevant structural features (ATP and GDP in green, Zn2+ in...
By proteomic analysis, we found a rhodanese-like protein(RhdA) from Acidithiobacillus ferrooxidans ATCC 23270 whose C-terminal contained a cysteine motif (Cys-XX-Trp-XX-Cys), known to bind iron–sulfur clusters. But so far, there were no articles to confirm the existence of iron–sulfur clus...
Cys31, Cys47, and Cys195 May Not Be Involved with the Disulfide Bond Formation Within the BinA Molecule The disulfide bond is a covalent bond that links 2 cysteine residues [14]. This bond plays an important role for maintaining 3D structure and function of some proteins such as growth horm...
CystinuriaAmino Acid Transport Systems, BasicAmino Acid Transport Systems, NeutralUreteroscopyNephrostomy, PercutaneousLithotripsyDietGenes, RecessiveCystinuria is an inherited disorder of the dibasic amino acid transport system in the proximal tubule and the small intestine. Two responsible genes have been...
Here utilizing an eddy-permitting ocean model (NEMO), we find that the complete removal of the New Zealand plateau leads to a smaller fraction of EAC transport heading east and more heading south, with the mean separation latitude shifting >100 km southward. To examine the underlying dynamics,...
Previous studies employed Sverdrup balance to associate a trend in basin wide zonally integrated wind stress curl (resulting from the multidecadal poleward intensification in the westerly winds over the Southern Ocean) with enhanced transport in the EAC extension. Possible regional drivers are yet to ...