JamesTheGiant wrote: ↑Mon Jul 31, 2023 5:38 am There's a sutta where the Buddha explains exactly this question "what are the benefits of jhana?" He lists 7 or 8 things... But i forget the sutta. Does anyone know it? you might be "thinking" (using the same vitakka as first...
stored even if the rate of storage per uTwnhaeirtmmairnaegjaoprisoctlhoenwalt.lieaFnlugorefthCfeoOrrm2Coohrveei,nram10ea0tnhdyaenatehrr(poCeuHrgioh4)do1ue6mt, ctiashsneiobEneus,rreaadsniuacinmedpgrobarystsailmnatnpdGrosHviiGsn,gtowliivitdehsetn2o5tcikftyimmpaernsaactgthiecemegselonthbt1aa7...
The results of 3 sub-studies nested within the CORONAVIT phase 3 open randomized, controlled trial in the UK revealed that the protective efficacy of the SARS-CoV-2 vaccine (n=2,808), the post-vaccine titers of anti-spike antibodies (n=1,853), or neutralizing antibody titers and antigen...
vitamins, and minerals that can help support overall health. Eating cucumbers in moderation as part of a balanced diet is generally considered safe for most people.
He generally recommends 0.5mg/kg up to 1mg/kg (pharmaceutical grade as any others have heavy metal contamination) taken with 1000 mg of Vit C in the ascorbic acid form as it reduces the MB to be bioactive. I just started taking 3drops in about 6oz of water per day, working up to a...
Vitamin K -- 1000 mcgs once a day. A Good quality fish oil (Vit A & D). I also think that it would be safe enough for you to take the Chanca Piedra -- 1000 mgs three times a day with meals -- or drink the tea form three times a day. This will help to gently dissolve and...
Potassium, K 171 mg (4 %) Sodium, Na 1 mg (0.04 %) Zinc, Zn 0.07 mg (0.5 %) Copper, Cu 0.148 mg (7 %) Manganese, Mn 0.055 mg (3 %) Selenium, Se 0.6 mcg (1 %) Vitamins: Vitamin C 71.5 mg (119 %) Thiamine (Vit. B1) 0.011 mg (0.7 %) Riboflavin (Vit. B2) 0.065 ...
Intriguingly, the retina, which is embryologically derived from brain tissue, shows characteristic AD pathology (i.e., soluble amyloid β-peptide oligomers and plaque, phosphorylated tau and neurofibrillary tangles) well before the appearance of AD pathology in the brain [16,17,18,19,20,21,26,...
Pyridoxine (vit B-6)0.119 mg9% Riboflavin0.038 mg3% Thiamin0.028 mg2.3% Vitamin C36.4 mg60% Vitamin A1080 IU36% Vitamin E0.9 mg6% Vitamin K4.2 µg3.5% Electrolytes Sodium1 mg0% Potassium168 mg3.7% Minerals Calcium11 mg1% Copper0.111 mg12% ...
(2010), fruits are also a rich source of vitamins tocopherol, carotene, vit-C, thiamine B1, and minerals like Ca, Mg, K, Fe and Mn. The most abundant mineral present in the plant is K (4370 mg/100g) followed by Ca (2459 mg/100g) and Mg (769 mg/100g) (Table 2). Decoction...