Analysis method of the amino acid in a biological sample using the enzyme altered function phenylalanine dehydrogenase, andPROBLEM TO BE SOLVED: To provide an adequate means as a technique for detection or primary screening of diseases of inborn error of metabolism in which blood abnormal ...
Guided by gut sensory cues, humans and animals prefer nutritive sugars over non-caloric sweeteners, but how the gut steers such preferences remains unknown. In the intestine, neuropod cells synapse with vagal neurons to convey sugar stimuli to the brain
For instance, data-independent acquisition (DIA) strategy allows the fragmentation of all precursor ions within a certain range of m/z and retention time, thus producing a complete record of all peptides in a sample3,4. This is in contrast to data-dependent acquisition (DDA) strategy which ...
Protein function prediction Analyze the following amino acid sequence, and determine the function of the resulting protein, its subcellular localization, and any biological processes it may be part of:MNGTVNASAPSKMSEVAVERLSNDKALKVIFVLGGPGSGKGTQCAKIAKHFGFTHLSVGDLLRAEINSGSKNGTMIESMINEGKIVRSEVTIKLLQRAMH...
The recommended shelf life for this product is 1 year from date of receipt.Application Note: For IHC, epitope retrieval with citrate buffer pH 6.0 is recommended for FFPE tissue sections. 靶标信息 QSER1 (glutamine and serine-rich protein 1) is a 1,735 amino acid protein that is phosphory...
and protein name predictions based on the amino acid sequence. This poses three major problems: First, sequence similarity searches can fail to result in significant matches if the sequence is too divergent from the ones present in databases. This is often the case when analyzing understudied speci...
We use essential cookies to make sure the site can function. We also use optional cookies for advertising, personalisation of content, usage analysis, and social media. By accepting optional cookies, you consent to the processing of your personal data - including transfers to third parties. Some...
The application of amino acid metabolomics in epidemiological studies has identified new biomarkers of diabetes mellitus (DM) and its complications, such as branched-chain amino acids, phenylalanine and arginine metabolites. This study focused on the analysis of metabolic amino acid profiling as a ...
Entire illumination of the hemisphere implies that the IBP sample binds to the whole ice crystal plane. It has been shown that the TH values of microbial IBPs are distributed over a wide range (0.1 − 4.0 °C)14,15. The IRI activity of microbial IBPs tends to be high compared ...
Based on this context, in the present study, a two-sample MR approach was used to analyze the causal impact of human serum metabolites on DR. The study also aimed to identify any common metabolites that may have a potential causal impact on DR. Lastly, we attempted to reveal the metabolic...