Alternatives to FBS and serum free media, that could help for the translation of cell therapy to the clinic, are human serum (hS), platelet-rich plasma (PRP) and human platelet lysate (hPL). When allogeneic hS is implemented in cell expansion hMSCs proliferation rate is reduced and the ...
Dey, K., Shrivastava, R., Kaushik, S., Subramaniam, L.V.: EmTaggeR: a word embedding based novel method for hashtag recommendation on Twitter. In: ICDM Workshops (2017) Ding, J., Dong, Y., Gao, T., Zhang, Z., Liu, Y.: Sentiment analysis of chinese micro-blog based on classif...
et al. Proteasome subunit Rpn13 is a novel ubiquitin receptor. Nature 453, 481–488 (2008). Article ADS CAS PubMed PubMed Central Google Scholar Schreiner, P. et al. Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction. Nature 453, 548–552 (2008). ...
Therefore, to miniaturize and reduce the cost of high-power electronic devices, novel materials for dielectric capacitors with dramatically improved energy density are required. PVDF with highly electronegative fluorine atoms exhibits relatively high permittivity and might be a competent candidate to con- ...
EKSGQRFLWVVRAPRVAIDDDDDSFNPRAEPDVDALLPAGFLERTTGRGVVVKLWAPQVDVLYHRATGAFVTHCGWN SVLEGITAGVPMLCWPLHSEQKMNMVLMVEEMDIAVEMAGWKQGLVTAEELEAKVRLVMESEAGSQLRARVTAHKEG AATAWADGGSSRSAFARRGKRKWEAPHCGAIARREDGEPEPKLCRPAAPTLPFPALLRHLPCSPRSPSAQPPLCRGL DRHPLSCLSSLRSGPPSATTFIFTTSRAHLSATIVIGAAIPTANFAVGVHGYGSEDLVG...
sensors Article A Novel Secure IoT-Based Smart Home Automation System Using a Wireless Sensor Network Sandeep Pirbhulal 1,2,3,†, Heye Zhang 1,2,†, Md Eshrat E Alahi 4,5, Hemant Ghayvat 4, Subhas Chandra Mukhopadhyay 4,5,*, Yuan-Ting Zhang 6 and Wanqing Wu 1,2,* 1 Shenzhen...
sensors Article A Novel Mass-Producible Capacitive Sensor with Fully Symmetric 3D Structure and Microfluidics for Cells Detection Zhaorui Zuo 1, Kun Wang 2, Libin Gao 3, Vincent Ho 4, Hongju Mao 2,* and Dahong Qian 1,* 1 School of Biomedical Engineering, Shanghai Jiao Tong University, ...
Surprisingly, this novel site is situated in the N-terminal section of Rpn1, a region previously surmised to be devoid of functionality. We identified a stretch of adjacent helices as the location of this previously uncharacterized binding site, whose spatial proximity and similar properties to the...
Novel compounds that act as EET and 20-HETE mimetics and antagonists have also been synthesized and extensively examined (Alonso-Galicia, Falck, Reddy, & Roman, 1999; Campbell, Imig, Schmitz, & Falck, 2017; Sudhahar, Shaw, & Imig, 2010). EET mimetics and sEH inhibitors have been ...
HPL Test (online text) 23. Alamout, Mt. Possibly related to Alamut, a mountainous region of northwest Iran [Alamut, Wikipedia 10/24/2020], or Mount Sinjar [Sinjar Mountains, Wikipedia 10/24/2020]. In Robert W. Chambers' novel The Slayer of Souls (1920), Mount Alamout is identified as...