Although the surfaces of the Fe slab became heterogeneous, it is reasonable because the original meteorites' surfaces would have some disorders due to ablation at high as shown in Fig. 1(b–d temperature. Note that several and e), respectively. Using this Nat2oamnidc Hco2nOfimguorlaetciou...
Nevertheless, the use of reduced representations enables us to tackle the problems of protein–protein interactions with spatiotemporal ranges that are beyond the accessibility of the all-atom model. Therefore, our CG model can be applied to biological systems that are difficult to study using previo...
thBoecthonoecmoincodmeivcelodpevmeelonpt manedntpoapnudlatpionpuglraotwiotnh ghraovwethsighnaivfiecasnigtnimifipcanctsiomnpuarcbtsanontraunrbspanortrdanemspaonrdt .dTemheainndt.erTrheleatiinotnesrrbeelatwtioenesn bveatrwioeuesndvyanraiomuisc dvyanriaambliecs vwairtihaibnlethsewsoitchioin-etc...
(lee7eiacr.nr)lve7Aaa..eF)vtA.f,uietgwef,rtuewree.rrtreeheAtrhee7ifme)cti.meocmroomotleihledniednigaigcatdoetdoeololywlywibnnbnrg,r,ooeeduuaagocgchhwhhttllnaoao,mmuuettiainsnscooaahttttehehlawawamttaaaasisnfofaoaabsbtstsetsececorworvovaoeliedslnidnogtogtbdohsdoehaworvawvnevenetodhctoehct...
dwTSinioohffl,fbeeuieerneletssnneuctrcorefeeesoa,r.vfaeToanmiocfldeoabrtotehefiernaseiulanwirafcelbheu,lreeeatenamlicmnfleeoatwohtrfeohianderefetillhsla.ietatobisnliiegnansmctaaelelrltothtafhoiAnedBawicAshceetcloeaelrn.ianbtsieotanildlseetnhntseiofiarescdcienbleydritafhfteieorenanbtsoewvnehseot...
Keywords: hybrid electric vehicle; energy recovery; braking strength; control strategy Academic Editor: Luis Vaccaro Received: 8 March 2021 Accepted: 10 April 2021 Published: 15 April 2021 Publisher's Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional ...
energies Article Validation through Experiment and Simulation of Internal Charging–Discharging Characteristics of Polyimide under High-Energy Electron Radiation Jiang Wu 1 , Bo Zhang 1,* , Yibo Zhi 1, Minheng He 1, Penghui Shang 2,3 and Yufeng Qian 4 1 School of Electronics and Information, ...
oimercatfetwstosaoldoiceiscttlAelslaia1caaetsmArnpnlaTnaaanamanfptnhnaaaa0DtothelalalshrDholDsstrtgalerlhhlohldl5ssstttgleallnfsotliia-yyecolifhiaie2cwi-s.cyeoofibiecwicesS.ysoonbtsaScor-stoin-bracssoaeoieTnn-sectfgteheaaTgnn-sieectfivslucangiersilhurstrlgtnruiihrsetrstsotueeeurhuathoeuwoteimet...
cTihateiobnanodf atht e10t4h8recemc−o1llcooidrrseswpaosnmdeadintloyAAl-lOO-6 C[2s6t]r.eTtchheinrgesvuilbtsraftoior nths.eC2o6.m4 pwatr%edswamitphl1e0awndt%thaelu3m1.2inwumt%ssoal,mthpele3l1o.2okwetd%thgeelsfiambeer,sihnaddi- acashtianrgptehraptetahke asitx1c0o4o8rcdmin−...
eB. It is important to note that, as shown in Table 2, the dimensionless numbers that define each Istimisuilmatipoonratraenntottoanlwoateysthroautn, dasnushmobwerns, ianndTainblseom2,etchaesedsiwmiethnisnioancelertsasinnCumaB boerrRsetBhgartoudpefithneey each simuclaatniohnavaereslnigohttl...